Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 1-50 (LV150)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 1-50 (LV150) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 1-50 IGLV1-50

UniProt

A0A075B6I6

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYVVHWYQQLPGTAPKLLIYGNSNRPSGVPDQFSGSKSGTSASLAITGLQSEDEADYYCKAWDNSLNA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Asperloxine A
bs-75721C 1 mg

Asperloxine A

Sign In for Pricing
View Details
KIF5A Antibody - middle region : HRP (ARP33868_P050-HRP)
ARP33868_P050-HRP 100 µL

KIF5A Antibody - middle region : HRP (ARP33868_P050-HRP)

Sign In for Pricing
View Details
Sheep P450scc ELISA Kit
ESC0081 96 Tests

Sheep P450scc ELISA Kit

Sign In for Pricing
View Details
FAM172A CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
19837154 3x 1.0 µg DNA

FAM172A CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Vasicinone
TB00088 5mg

Vasicinone

Sign In for Pricing
View Details
RHOT2 Polyclonal Antibody
MBS2566314-01 0.06 mL

RHOT2 Polyclonal Antibody

Sign In for Pricing
View Details