Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 7-46 (LV746)

This Recombinant Human Immunoglobulin lambda variable 7-46 (LV746) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 7-46 IGLV7-46

UniProt

A0A075B6I9

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLLGAQPEDEAEYYCLLSYSGAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRK2 Rabbit Polyclonal Antibody
orb213536-01 30 µL

GRK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GRK2 Rabbit Polyclonal Antibody
orb213536-02 50 μL

GRK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GRK2 Rabbit Polyclonal Antibody
orb213536-03 100 µL

GRK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GRK2 Rabbit Polyclonal Antibody
orb213536-04 200 µL

GRK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-(2-Ethoxyphenoxy)ethanamine Hydrochloride
TRC-E892885-100MG 100 mg

2-(2-Ethoxyphenoxy)ethanamine Hydrochloride

Sign In for Pricing
View Details
3-Bromo-4-oxo-piperidine-1-carboxylic acid ethyl ester
266724-01 500 mg

3-Bromo-4-oxo-piperidine-1-carboxylic acid ethyl ester

Sign In for Pricing
View Details