Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-37 (LV537)

This Recombinant Human Immunoglobulin lambda variable 5-37 (LV537) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-37 IGLV5-37

UniProt

A0A075B6J1

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPPSSSASPGESARLTCTLPSDINVGSYNIYWYQQKPGSPPRYLLYYYSDSDKGQGSGVPSRFSGSKDASANTGILLISGLQSEDEADYYCMIWPSNAS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Mercapto-1-phenethyl-5,6,7,8-tetrahydro-isoquinoline-4-carbonitrile
sc-347003 250 mg

3-Mercapto-1-phenethyl-5,6,7,8-tetrahydro-isoquinoline-4-carbonitrile

Sign In for Pricing
View Details
Porcine anti-adrenocortical antibody (AAA) ELISA Kit
EIA05181p 1 Kit

Porcine anti-adrenocortical antibody (AAA) ELISA Kit

Sign In for Pricing
View Details
RESP18 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
38828111 3x 1.0 µg

RESP18 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Human ALDH5A1, His-tagged
ALDH5A1-9562H 25 µg

Recombinant Human ALDH5A1, His-tagged

Sign In for Pricing
View Details
Wisp1 (NM_018865) Mouse Tagged ORF Clone
MG205645 10 µg

Wisp1 (NM_018865) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
KU 0063794
MBS131988-01 100 mg

KU 0063794

Sign In for Pricing
View Details