Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 2-33 IGLV2-33

UniProt

A0A075B6J2

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPFVSGAPGQSVTISCTGTSSDVGDYDHVFWYQKRLSTTSRLLIYNVNTRPSGISDLFSGSKSGNMASLTISGLKSEVEANYHCSLYSSSYTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COPS5 Polyclonal Antibody
E-AB-64612-01 60 µL

COPS5 Polyclonal Antibody

Sign In for Pricing
View Details
COPS5 Polyclonal Antibody
E-AB-64612-02 120 µL

COPS5 Polyclonal Antibody

Sign In for Pricing
View Details
COPS5 Polyclonal Antibody
E-AB-64612-03 200 µL

COPS5 Polyclonal Antibody

Sign In for Pricing
View Details
PATL1, CT (PATL1, Protein PAT1 homolog 1, PAT1-like protein 1, Protein PAT1 homolog b) (Azide free) (HRP) discontinued
039694-HRP 200 µL

PATL1, CT (PATL1, Protein PAT1 homolog 1, PAT1-like protein 1, Protein PAT1 homolog b) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
MEF2A, ID (MEF2A, MEF2, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1) (AP)
MBS6320089-01 0.2 mL

MEF2A, ID (MEF2A, MEF2, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1) (AP)

Sign In for Pricing
View Details
MEF2A, ID (MEF2A, MEF2, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1) (AP)
MBS6320089-02 5x 0.2 mL

MEF2A, ID (MEF2A, MEF2, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1) (AP)

Sign In for Pricing
View Details