Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 2-33 IGLV2-33

UniProt

A0A075B6J2

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPFVSGAPGQSVTISCTGTSSDVGDYDHVFWYQKRLSTTSRLLIYNVNTRPSGISDLFSGSKSGNMASLTISGLKSEVEANYHCSLYSSSYTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp36l2 (NM_001036626) Rat Tagged ORF Clone
RR202540 10 µg

Zfp36l2 (NM_001036626) Rat Tagged ORF Clone

Sign In for Pricing
View Details
PHF7 (PHD Finger Protein 7, DKFZp434L1850, HSPC045, HSPC226, MGC26088, NYD-SP6) (HRP)
250058-HRP 100 µL

PHF7 (PHD Finger Protein 7, DKFZp434L1850, HSPC045, HSPC226, MGC26088, NYD-SP6) (HRP)

Sign In for Pricing
View Details
LentimiRa-Off-hsa-miR-548as-3p Vector
mh31925 500 ng

LentimiRa-Off-hsa-miR-548as-3p Vector

Sign In for Pricing
View Details
Human Dectin-2/CLEC6A MAb (Clone 545925)
MAB31141-100 100 µg

Human Dectin-2/CLEC6A MAb (Clone 545925)

Sign In for Pricing
View Details
Hspb7 Rat shRNA Lentiviral Particle (Locus ID 50565)
TL711415V 500 µL Each

Hspb7 Rat shRNA Lentiviral Particle (Locus ID 50565)

Sign In for Pricing
View Details
Mouse Monoclonal VASP Antibody (OTI4D6) [Alexa Fluor 750]
NBP2-74830AF750 0.1 mL

Mouse Monoclonal VASP Antibody (OTI4D6) [Alexa Fluor 750]

Sign In for Pricing
View Details