Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-22 (LV322)

This Recombinant Human Immunoglobulin lambda variable 3-22 (LV322) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-22 IGLV3-22

UniProt

A0A075B6J6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQLPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPELVIYEDSERYPGIPERFSGSTSGNTTTLTISRVLTEDEADYYCLSGDEDNPS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACOX1 Polyclonal Antibody
MBS2540079-01 0.06 mL

ACOX1 Polyclonal Antibody

Sign In for Pricing
View Details
ACOX1 Polyclonal Antibody
MBS2540079-02 0.12 mL

ACOX1 Polyclonal Antibody

Sign In for Pricing
View Details
ACOX1 Polyclonal Antibody
MBS2540079-03 0.2 mL

ACOX1 Polyclonal Antibody

Sign In for Pricing
View Details
ACOX1 Polyclonal Antibody
MBS2540079-04 5x 0.2 mL

ACOX1 Polyclonal Antibody

Sign In for Pricing
View Details
PEBP1P1 Protein Vector (Human) (pPB-N-His)
PV110387 500 ng

PEBP1P1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
LYPLA1 antibody
70R-51701 100 µL

LYPLA1 antibody

Sign In for Pricing
View Details