Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-22 (LV322)

This Recombinant Human Immunoglobulin lambda variable 3-22 (LV322) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-22 IGLV3-22

UniProt

A0A075B6J6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQLPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPELVIYEDSERYPGIPERFSGSTSGNTTTLTISRVLTEDEADYYCLSGDEDNPS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TMEM63A Protein - (Dry Ice)
H00009725-P01-2ug 2 µg

Recombinant Human TMEM63A Protein - (Dry Ice)

Sign In for Pricing
View Details
Folic acid-BSA
80-1451 1 mg

Folic acid-BSA

Sign In for Pricing
View Details
Bikaverin
HY-121004-01 500 µg

Bikaverin

Sign In for Pricing
View Details
Bikaverin
HY-121004-02 1 mg

Bikaverin

Sign In for Pricing
View Details
PI4K2A, CT (PI4K2A, Phosphatidylinositol 4-kinase type 2-alpha, Phosphatidylinositol 4-kinase type II-alpha) (PE)
MBS6333771-01 0.2 mL

PI4K2A, CT (PI4K2A, Phosphatidylinositol 4-kinase type 2-alpha, Phosphatidylinositol 4-kinase type II-alpha) (PE)

Sign In for Pricing
View Details
PI4K2A, CT (PI4K2A, Phosphatidylinositol 4-kinase type 2-alpha, Phosphatidylinositol 4-kinase type II-alpha) (PE)
MBS6333771-02 5x 0.2 mL

PI4K2A, CT (PI4K2A, Phosphatidylinositol 4-kinase type 2-alpha, Phosphatidylinositol 4-kinase type II-alpha) (PE)

Sign In for Pricing
View Details