Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-22 (LV322)

This Recombinant Human Immunoglobulin lambda variable 3-22 (LV322) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-22 IGLV3-22

UniProt

A0A075B6J6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQLPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPELVIYEDSERYPGIPERFSGSTSGNTTTLTISRVLTEDEADYYCLSGDEDNPS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRMT6 Protein (N-His, Human)
P507419 100 µg

PRMT6 Protein (N-His, Human)

Sign In for Pricing
View Details
Human COMT AssayLite™ Antibody (RPE Conjugate)
32622-05151 5x 30 µg

Human COMT AssayLite™ Antibody (RPE Conjugate)

Sign In for Pricing
View Details
ADO antibody
70R-15605 50 μL

ADO antibody

Sign In for Pricing
View Details
DCAMKL2 (DCLK2) (NM_001040260) Human 3' UTR Clone
SC213211 10 µg

DCAMKL2 (DCLK2) (NM_001040260) Human 3' UTR Clone

Sign In for Pricing
View Details
Crb1 Mouse siRNA Oligo Duplex (Locus ID 170788)
SR422805 1 Kit

Crb1 Mouse siRNA Oligo Duplex (Locus ID 170788)

Sign In for Pricing
View Details
Clec4n 3'UTR GFP Stable Cell Line
TU154013 1.0 mL

Clec4n 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details