Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 2-18 (LV218)

This Recombinant Human Immunoglobulin lambda variable 2-18 (LV218) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 2-18 IGLV2-18

UniProt

A0A075B6J9

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPSVSGSPGQSVTISCTGTSSDVGSYNRVSWYQQPPGTAPKLMIYEVSNRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCSLYTSSSTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human UBXN6 sgRNA gene knockout kit - Lentiviral human UBXN6 sgRNA gene knockout kit (100)
GTR15399040 1 Vial

Lentiviral human UBXN6 sgRNA gene knockout kit - Lentiviral human UBXN6 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
1110032A03Rik 3'UTR Lenti-reporter-Luc Vector
10049084 1.0 µg

1110032A03Rik 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CCDC97 ORF Vector (Human) (pORF)
ORF002030 1.0 µg DNA

CCDC97 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
MGAT5B Recombinant Protein (Human)
RP019300 100 µg

MGAT5B Recombinant Protein (Human)

Sign In for Pricing
View Details
Goat Fructose 1, 6 bisphosphate aldolase ELISA Kit
GTR10336476 96 Well

Goat Fructose 1, 6 bisphosphate aldolase ELISA Kit

Sign In for Pricing
View Details
Chicken TOLLIP / Toll-interacting protein Recombinant Protein
R15227c 1 Each

Chicken TOLLIP / Toll-interacting protein Recombinant Protein

Sign In for Pricing
View Details