Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-12 (LV312)

This Recombinant Human Immunoglobulin lambda variable 3-12 (LV312) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-12 IGLV3-12

UniProt

A0A075B6K2

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQPHSVSVATAQMARITCGGNNIGSKAVHWYQQKPGQDPVLVIYSDSNRPSGIPERFSGSNPGNTATLTISRIEAGDEADYYCQVWDSSSDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL4 Rabbit Polyclonal Antibody
orb402190 100 µg

IL4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COX6B1 Polyclonal Antibody, FITC Conjugated
A51611-050 50 µL

COX6B1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
PEX5L 293 Cell Lysate
406678 0.1 mg

PEX5L 293 Cell Lysate

Sign In for Pricing
View Details
Anti-Androgen receptor Rabbit pAb
GB115424-100 100 μL

Anti-Androgen receptor Rabbit pAb

Sign In for Pricing
View Details
Avpi1 3'UTR GFP Stable Cell Line
TU152418 1.0 mL

Avpi1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
2-Vinylbenzeneboronic acid, propane-1,3-diol ester
OR3947 1 Each

2-Vinylbenzeneboronic acid, propane-1,3-diol ester

Sign In for Pricing
View Details