Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-12 (LV312)

This Recombinant Human Immunoglobulin lambda variable 3-12 (LV312) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-12 IGLV3-12

UniProt

A0A075B6K2

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQPHSVSVATAQMARITCGGNNIGSKAVHWYQQKPGQDPVLVIYSDSNRPSGIPERFSGSNPGNTATLTISRIEAGDEADYYCQVWDSSSDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit IL-9 ELISA Kit
orb567979-01 48 Tests

Rabbit IL-9 ELISA Kit

Sign In for Pricing
View Details
Rabbit IL-9 ELISA Kit
orb567979-02 96 Tests

Rabbit IL-9 ELISA Kit

Sign In for Pricing
View Details
Rat Cytochrome P450 7A1, CYP7A1 ELISA KIT
E0915Ra-01 48 Well

Rat Cytochrome P450 7A1, CYP7A1 ELISA KIT

Sign In for Pricing
View Details
Rat Cytochrome P450 7A1, CYP7A1 ELISA KIT
E0915Ra-02 96 Well

Rat Cytochrome P450 7A1, CYP7A1 ELISA KIT

Sign In for Pricing
View Details
Rat Cytochrome P450 7A1, CYP7A1 ELISA KIT
E0915Ra-03 5x 96 Tests

Rat Cytochrome P450 7A1, CYP7A1 ELISA KIT

Sign In for Pricing
View Details
Rat Cytochrome P450 7A1, CYP7A1 ELISA KIT
E0915Ra-04 10x 96 Tests

Rat Cytochrome P450 7A1, CYP7A1 ELISA KIT

Sign In for Pricing
View Details