Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-9 (LV39)

This Recombinant Human Immunoglobulin lambda variable 3-9 (LV39) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-9 IGLV3-9

UniProt

A0A075B6K5

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQPLSVSVALGQTARITCGGNNIGSKNVHWYQQKPGQAPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISRAQAGDEADYYCQVWDSSTAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL4 Antibody
35227-01 50 µL

IL4 Antibody

Sign In for Pricing
View Details
IL4 Antibody
35227-02 100 µL

IL4 Antibody

Sign In for Pricing
View Details
ARFGAP2 antibody
FNab00537 100 µg

ARFGAP2 antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
MBS1138574-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O7:K1 Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
MBS1138574-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O7:K1 Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
MBS1138574-03 0.02 mg (Yeast)

Recombinant Escherichia coli O7:K1 Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)

Sign In for Pricing
View Details