Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-3 (LV403)

This Recombinant Human Immunoglobulin lambda variable 4-3 (LV403) spans the amino acid sequence from region 20-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-3 IGLV4-3

UniProt

A0A075B6K6

Expression Region

20-122

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LPVLTQPPSASALLGASIKLTCTLSSEHSTYTIEWYQQRPGRSPQYIMKVKSDGSHSKGDGIPDRFMGSSSGADRYLTFSNLQSDDEAEYHCGESHTIDGQVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EHD3 Rabbit Polyclonal Antibody
MBS9514362-01 0.05 mL

EHD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EHD3 Rabbit Polyclonal Antibody
MBS9514362-02 0.1 mL

EHD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EHD3 Rabbit Polyclonal Antibody
MBS9514362-03 5x 0.1 mL

EHD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EEF1G Polyclonal Antibody
E-AB-65564-01 60 µL

EEF1G Polyclonal Antibody

Sign In for Pricing
View Details
EEF1G Polyclonal Antibody
E-AB-65564-02 120 µL

EEF1G Polyclonal Antibody

Sign In for Pricing
View Details
EEF1G Polyclonal Antibody
E-AB-65564-03 200 µL

EEF1G Polyclonal Antibody

Sign In for Pricing
View Details