Recombinant Human T cell receptor beta variable 20-1 (TVBT1)
This Recombinant Human T cell receptor beta variable 20-1 (TVBT1) spans the amino acid sequence from region 16-111. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
T cell receptor beta variable 20-1 TRBV20-1
UniProt
A0A075B6N2
Expression Region
16-111
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
AVVSQHPSRVICKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSAR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
#92455 1 Kit
Mix-n-StainTM CF®583R Antibody Labeling Kit, 1x (5-20ug) labeling
Sign In for Pricing
View Details 
