Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 20-1 (TVBT1)

This Recombinant Human T cell receptor beta variable 20-1 (TVBT1) spans the amino acid sequence from region 16-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 20-1 TRBV20-1

UniProt

A0A075B6N2

Expression Region

16-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVVSQHPSRVICKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBA1 Rabbit Polyclonal Antibody
TA376937 100 µL

HBA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPATA22 Mouse Monoclonal Antibody [Clone ID: OTI6H9]
CF808420 100 µg

SPATA22 Mouse Monoclonal Antibody [Clone ID: OTI6H9]

Sign In for Pricing
View Details
PE/AF594 Anti-Mouse TER-119 Antibody
RD30293F-01 25 µg

PE/AF594 Anti-Mouse TER-119 Antibody

Sign In for Pricing
View Details
PE/AF594 Anti-Mouse TER-119 Antibody
RD30293F-02 100 µg

PE/AF594 Anti-Mouse TER-119 Antibody

Sign In for Pricing
View Details
DPYSL4 Antibody
KC-44859-01 50 μL

DPYSL4 Antibody

Sign In for Pricing
View Details
DPYSL4 Antibody
KC-44859-02 100 µL

DPYSL4 Antibody

Sign In for Pricing
View Details