Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 24-1 (TVBX1)

This Recombinant Human T cell receptor beta variable 24-1 (TVBX1) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 24-1 TRBV24-1

UniProt

A0A075B6N3

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLQLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Capg Pre-designed siRNA Set B
SI201937B 1 Each

Rat Capg Pre-designed siRNA Set B

Sign In for Pricing
View Details
KLF4, CT (KLF4, EZF, GKLF, Krueppel-like factor 4, Epithelial zinc finger protein EZF, Gut-enriched krueppel-like factor) (AP)
MBS6313985-01 0.2 mL

KLF4, CT (KLF4, EZF, GKLF, Krueppel-like factor 4, Epithelial zinc finger protein EZF, Gut-enriched krueppel-like factor) (AP)

Sign In for Pricing
View Details
KLF4, CT (KLF4, EZF, GKLF, Krueppel-like factor 4, Epithelial zinc finger protein EZF, Gut-enriched krueppel-like factor) (AP)
MBS6313985-02 5x 0.2 mL

KLF4, CT (KLF4, EZF, GKLF, Krueppel-like factor 4, Epithelial zinc finger protein EZF, Gut-enriched krueppel-like factor) (AP)

Sign In for Pricing
View Details
Phospho-Tau (Thr50) Rabbit mAb, 1 pack = 50 µL
BAL2272 1 Each

Phospho-Tau (Thr50) Rabbit mAb, 1 pack = 50 µL

Sign In for Pricing
View Details
2-Chloro-5-nitrobenzophenone
C15945-01 5 g

2-Chloro-5-nitrobenzophenone

Sign In for Pricing
View Details
2-Chloro-5-nitrobenzophenone
C15945-02 25 g

2-Chloro-5-nitrobenzophenone

Sign In for Pricing
View Details