Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 24-1 (TVBX1)

This Recombinant Human T cell receptor beta variable 24-1 (TVBX1) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 24-1 TRBV24-1

UniProt

A0A075B6N3

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLQLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GPR83 Alexa Fluor 405 Antibody (Clone 566133)
FAB10943V-100UG 100 µg

Human GPR83 Alexa Fluor 405 Antibody (Clone 566133)

Sign In for Pricing
View Details
0610007P14Rik Protein Vector (Mouse) (pPM-C-HA)
PV146124 500 ng

0610007P14Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Claudin 5 Rabbit Polyclonal Antibody, 1 pack = 50 µL
BAL4458 1 Each

Claudin 5 Rabbit Polyclonal Antibody, 1 pack = 50 µL

Sign In for Pricing
View Details
ANXA4 & PKN1 Protein (N-GST, Human)
P522183 100 µg

ANXA4 & PKN1 Protein (N-GST, Human)

Sign In for Pricing
View Details
NAP1L1P3 ORF Vector (Human) (pORF)
ORF025901 1.0 µg DNA

NAP1L1P3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Chicken Eukaryotic initiation factor 4A-II, EIF4A2 ELISA KIT
ELI-20517c 96 Tests

Chicken Eukaryotic initiation factor 4A-II, EIF4A2 ELISA KIT

Sign In for Pricing
View Details