Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 24-1 (TVBX1)

This Recombinant Human T cell receptor beta variable 24-1 (TVBX1) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 24-1 TRBV24-1

UniProt

A0A075B6N3

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLQLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5′ LC®Cyan500 / 3′ BHQ-1® (5 to 9 nmol)
JBS-FP-120-05 5 nmol

5′ LC®Cyan500 / 3′ BHQ-1® (5 to 9 nmol)

Sign In for Pricing
View Details
Bcl-w (BH3 Domain Specific) Antibody Blocking peptide
orb1457532 500 µg

Bcl-w (BH3 Domain Specific) Antibody Blocking peptide

Sign In for Pricing
View Details
Rat Alpha-Fetoprotein Lens Culinaris Agglutinin 3 (AFPL3) ELISA Kit
SL1185Ra-01 48 Tests

Rat Alpha-Fetoprotein Lens Culinaris Agglutinin 3 (AFPL3) ELISA Kit

Sign In for Pricing
View Details
Rat Alpha-Fetoprotein Lens Culinaris Agglutinin 3 (AFPL3) ELISA Kit
SL1185Ra-02 96 Tests

Rat Alpha-Fetoprotein Lens Culinaris Agglutinin 3 (AFPL3) ELISA Kit

Sign In for Pricing
View Details
Human Matrix Metalloproteinase 15 (MMP-15) ELISA Kit
YP-W15151-01 48 Tests

Human Matrix Metalloproteinase 15 (MMP-15) ELISA Kit

Sign In for Pricing
View Details
Human Matrix Metalloproteinase 15 (MMP-15) ELISA Kit
YP-W15151-02 96 Tests

Human Matrix Metalloproteinase 15 (MMP-15) ELISA Kit

Sign In for Pricing
View Details