Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 25-1 (TVBY1)

This Recombinant Human T cell receptor beta variable 25-1 (TVBY1) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 25-1 TRBV25-1

UniProt

A0A075B6N4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-O-Dodecyl-rac-glycerol
TRC-D525520-1G 1 g

1-O-Dodecyl-rac-glycerol

Sign In for Pricing
View Details
Cytokeratin 6A (KRT6A) (Basal Cell Marker) (rKRT6A/2100), CF647 conjugate, 0.1mg/mL
BNC473799-500 1x 500 µL

Cytokeratin 6A (KRT6A) (Basal Cell Marker) (rKRT6A/2100), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIM 3 (HAVCR2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]
TA812558AM 100 µL

TIM 3 (HAVCR2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]

Sign In for Pricing
View Details
GAS41 (YEATS4) Rabbit Polyclonal Antibody
AP06652PU-N 100 µg

GAS41 (YEATS4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
beta 1 Adrenergic Receptor (ADRB1) Human Gene Knockout Kit (CRISPR)
KN217134LP 1 Kit

beta 1 Adrenergic Receptor (ADRB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD25/ IL2RA (Activated Lymphocyte Marker) (IL2RA/2395), CF594 conjugate, 0.1mg/mL
BNC942395-100 1x 100 µL

CD25/ IL2RA (Activated Lymphocyte Marker) (IL2RA/2395), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details