Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 25-1 (TVBY1)

This Recombinant Human T cell receptor beta variable 25-1 (TVBY1) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 25-1 TRBV25-1

UniProt

A0A075B6N4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eicosapentaenoic Acid Ethyl Ester
TRC-E476880-10MG 10 mg

Eicosapentaenoic Acid Ethyl Ester

Sign In for Pricing
View Details
HSP27 (HSPB1/774), CF770 conjugate, 0.1mg/mL
BNC700774-500 1x 500 µL

HSP27 (HSPB1/774), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Rat Tie2/TEK Protein (Fc Tag)
PKSR030377 200 µg

Recombinant Rat Tie2/TEK Protein (Fc Tag)

Sign In for Pricing
View Details
Dibenzyl Dicarbonate
TRC-D417540-2.5G 2.5 g

Dibenzyl Dicarbonate

Sign In for Pricing
View Details
Mapk8ip2 Mouse Monoclonal Antibody [Clone ID: N135/37]
75-163 100 µL

Mapk8ip2 Mouse Monoclonal Antibody [Clone ID: N135/37]

Sign In for Pricing
View Details
Hydroxystilbamidine, 4% in H2O
#80023 1x 200 µL

Hydroxystilbamidine, 4% in H2O

Sign In for Pricing
View Details