Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 25-1 (TVBY1)

This Recombinant Human T cell receptor beta variable 25-1 (TVBY1) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 25-1 TRBV25-1

UniProt

A0A075B6N4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM229B Human Gene Knockout Kit (CRISPR)
KN211212BN 1 Kit

TMEM229B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
JAK3 Mouse Monoclonal Antibody [Clone ID: OTI1B4]
CF812815 100 µg

JAK3 Mouse Monoclonal Antibody [Clone ID: OTI1B4]

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sealing Film
SF061PP-SLT-PRT 500 Units/Case

Sealing Film

Sign In for Pricing
View Details
(E)-3-(3-(2-Ethoxyphenyl)-3-oxoprop-1-en-1-yl)quinolin-2(1H)-one
TRC-E123668-250MG 250 mg

(E)-3-(3-(2-Ethoxyphenyl)-3-oxoprop-1-en-1-yl)quinolin-2(1H)-one

Sign In for Pricing
View Details
Mouse Dpp6 activation kit by CRISPRa
GA201122 1 Kit

Mouse Dpp6 activation kit by CRISPRa

Sign In for Pricing
View Details