Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 25-1 (TVBY1)

This Recombinant Human T cell receptor beta variable 25-1 (TVBY1) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 25-1 TRBV25-1

UniProt

A0A075B6N4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SMARCB1 Protein, His, Yeast-200ug
QP7605-ye-200ug 200ug

Recombinant Human SMARCB1 Protein, His, Yeast-200ug

Sign In for Pricing
View Details
FMO2 (NM_001460) Human Tagged Lenti ORF Clone
RC203237L3 10 µg

FMO2 (NM_001460) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PHYH sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1644408 1.0 µg DNA

PHYH sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
EIF3A Recombinant Rabbit mAb, Cy3 conjugated
orb3183923 100 µL

EIF3A Recombinant Rabbit mAb, Cy3 conjugated

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Probable calcium-activated outward-rectifying potassium channel 2 (KCO2)
MBS7017811-01 0.02 mg

Recombinant Arabidopsis thaliana Probable calcium-activated outward-rectifying potassium channel 2 (KCO2)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Probable calcium-activated outward-rectifying potassium channel 2 (KCO2)
MBS7017811-02 0.1 mg

Recombinant Arabidopsis thaliana Probable calcium-activated outward-rectifying potassium channel 2 (KCO2)

Sign In for Pricing
View Details