Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-28 (KV228)

This Recombinant Human Immunoglobulin kappa variable 2-28 (KV228) spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-28 IGKV2-28

UniProt

A0A075B6P5

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Med1 shRNA (UAS) - Lentiviral mouse Med1 shRNA (UAS) (25)
GTR15225353 1 Vial

Lentiviral mouse Med1 shRNA (UAS) - Lentiviral mouse Med1 shRNA (UAS) (25)

Sign In for Pricing
View Details
1- (5-bromo-2-fluoro-3- (methylthio) phenyl) -2,2-dimethylpropan-1-ol
PC1019878-01 250 mg

1- (5-bromo-2-fluoro-3- (methylthio) phenyl) -2,2-dimethylpropan-1-ol

Sign In for Pricing
View Details
1- (5-bromo-2-fluoro-3- (methylthio) phenyl) -2,2-dimethylpropan-1-ol
PC1019878-02 500 mg

1- (5-bromo-2-fluoro-3- (methylthio) phenyl) -2,2-dimethylpropan-1-ol

Sign In for Pricing
View Details
Rabbit Polyclonal DRP2 Antibody
NBP2-92258-0.1mL 0.1 mL

Rabbit Polyclonal DRP2 Antibody

Sign In for Pricing
View Details
Phospho-MEF2A (Ser408) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-3268R-BF555-01 20 µL

Phospho-MEF2A (Ser408) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Phospho-MEF2A (Ser408) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-3268R-BF555-02 100 µL

Phospho-MEF2A (Ser408) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details