Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-28 (KV228)

This Recombinant Human Immunoglobulin kappa variable 2-28 (KV228) spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-28 IGKV2-28

UniProt

A0A075B6P5

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TIPARP knockdown cell line
ABC-KD15445 1 Vial

Human TIPARP knockdown cell line

Sign In for Pricing
View Details
GPR43 (FFAR2) (NM_005306) Human Tagged Lenti ORF Clone
RC217983L4 10 µg

GPR43 (FFAR2) (NM_005306) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human MBP ELISA Kit (Colorimetric)
NBP2-81165 1 Kit

Human MBP ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Wnk1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7083308 1.0 µg DNA

Wnk1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
DTL (Denticleless Protein Homolog, DDB1-and CUL4-associated Factor 2, Lethal(2) Denticleless Protein Homolog, Retinoic Acid-regulated Nuclear Matrix-associated Protein, CDT2, CDW1, DCAF2, L2DTL, RAMP) (MaxLight 750)
MBS6376621-01 0.1 mL

DTL (Denticleless Protein Homolog, DDB1-and CUL4-associated Factor 2, Lethal(2) Denticleless Protein Homolog, Retinoic Acid-regulated Nuclear Matrix-associated Protein, CDT2, CDW1, DCAF2, L2DTL, RAMP) (MaxLight 750)

Sign In for Pricing
View Details
DTL (Denticleless Protein Homolog, DDB1-and CUL4-associated Factor 2, Lethal(2) Denticleless Protein Homolog, Retinoic Acid-regulated Nuclear Matrix-associated Protein, CDT2, CDW1, DCAF2, L2DTL, RAMP) (MaxLight 750)
MBS6376621-02 5x 0.1 mL

DTL (Denticleless Protein Homolog, DDB1-and CUL4-associated Factor 2, Lethal(2) Denticleless Protein Homolog, Retinoic Acid-regulated Nuclear Matrix-associated Protein, CDT2, CDW1, DCAF2, L2DTL, RAMP) (MaxLight 750)

Sign In for Pricing
View Details