Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64 (HV364)

This Recombinant Human Immunoglobulin heavy variable 3-64 (HV364) spans the amino acid sequence from region 21-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64 IGHV3-64

UniProt

A0A075B6Q5

Expression Region

21-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGEGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human APOL6 Pre-designed siRNA Set B
SI000885B 1 Each

Human APOL6 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral human SLC7A1 shRNA (UAS) - Lentiviral human SLC7A1 shRNA (UAS, GFP) plasmid
GTR15105862 1 Vial

Lentiviral human SLC7A1 shRNA (UAS) - Lentiviral human SLC7A1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Anti-TSSC4 Antibody
CTA1489-01 30 µL

Anti-TSSC4 Antibody

Sign In for Pricing
View Details
Anti-TSSC4 Antibody
CTA1489-02 50 μL

Anti-TSSC4 Antibody

Sign In for Pricing
View Details
Anti-TSSC4 Antibody
CTA1489-03 100 µL

Anti-TSSC4 Antibody

Sign In for Pricing
View Details
Anti-TSSC4 Antibody
CTA1489-04 200 µL

Anti-TSSC4 Antibody

Sign In for Pricing
View Details