Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64 (HV364)

This Recombinant Human Immunoglobulin heavy variable 3-64 (HV364) spans the amino acid sequence from region 21-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64 IGHV3-64

UniProt

A0A075B6Q5

Expression Region

21-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGEGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal p40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker) Antibody - With BSA and Azide
APR00536G 50 ug

Polyclonal p40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker) Antibody - With BSA and Azide

Sign In for Pricing
View Details
Betaxolol
C16637-10mM/1mL 10 mM/1mL

Betaxolol

Sign In for Pricing
View Details
Multiplex Assay Kit for Interleukin 6 (IL6), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0025390 96 Tests

Multiplex Assay Kit for Interleukin 6 (IL6), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Rabbit anti-IL-1RL2 Antibody
YLD4310-01 50 µL

Rabbit anti-IL-1RL2 Antibody

Sign In for Pricing
View Details
Rabbit anti-IL-1RL2 Antibody
YLD4310-02 100 µL

Rabbit anti-IL-1RL2 Antibody

Sign In for Pricing
View Details
NOP14-AS1 AAV Vector (Human) (CMV)
31998101 1 µg

NOP14-AS1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details