Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64 (HV364)

This Recombinant Human Immunoglobulin heavy variable 3-64 (HV364) spans the amino acid sequence from region 21-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64 IGHV3-64

UniProt

A0A075B6Q5

Expression Region

21-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGEGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC38A5 (NM_033518) Human Tagged ORF Clone Lentiviral Particle
RC200795L3V 200 µL

SLC38A5 (NM_033518) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GGCX Antibody - middle region : FITC (ARP44340_P050-FITC)
ARP44340_P050-FITC 100 µL

GGCX Antibody - middle region : FITC (ARP44340_P050-FITC)

Sign In for Pricing
View Details
Recombinant Thermobifida fusca NADH-quinone oxidoreductase subunit K (nuoK)
MBS7024211-01 0.02 mg

Recombinant Thermobifida fusca NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
Recombinant Thermobifida fusca NADH-quinone oxidoreductase subunit K (nuoK)
MBS7024211-02 0.1 mg

Recombinant Thermobifida fusca NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
Recombinant Thermobifida fusca NADH-quinone oxidoreductase subunit K (nuoK)
MBS7024211-03 5x 0.1 mg

Recombinant Thermobifida fusca NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
JIP3 (MAPK8IP3) Human shRNA Plasmid Kit (Locus ID 23162)
TL311574 1 Kit

JIP3 (MAPK8IP3) Human shRNA Plasmid Kit (Locus ID 23162)

Sign In for Pricing
View Details