Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64 (HV364)

This Recombinant Human Immunoglobulin heavy variable 3-64 (HV364) spans the amino acid sequence from region 21-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64 IGHV3-64

UniProt

A0A075B6Q5

Expression Region

21-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGEGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTNNBL1 Polyclonal Antibody
RD83913A-01 60 μL

CTNNBL1 Polyclonal Antibody

Sign In for Pricing
View Details
CTNNBL1 Polyclonal Antibody
RD83913A-02 120 μL

CTNNBL1 Polyclonal Antibody

Sign In for Pricing
View Details
CTNNBL1 Polyclonal Antibody
RD83913A-03 200 µL

CTNNBL1 Polyclonal Antibody

Sign In for Pricing
View Details
Olfr223 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4216603 1.0 µg DNA

Olfr223 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
TMEM265 (NM_001256829) Human Tagged ORF Clone
RG235668 10 µg

TMEM265 (NM_001256829) Human Tagged ORF Clone

Sign In for Pricing
View Details
ALPL Antibody
MBS7131776-01 0.1 mL

ALPL Antibody

Sign In for Pricing
View Details