Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 2 (TRGV2)

This Recombinant Human T cell receptor gamma variable 2 (TRGV2) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 2 TRGV2 TCRGV2

UniProt

A0A075B6R0

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVIRQTGSSAEITCDLAEGSNGYIHWYLHQEGKAPQRLQYYDSYNSKVVLESGVSPGKYYTYASTRNNLRLILRNLIENDFGVYYCATWDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2′,4,4′-Tetrabromo-6-hydroxydiphenyl ether-13C12
HY-166960S 1 Each

2,2′,4,4′-Tetrabromo-6-hydroxydiphenyl ether-13C12

Sign In for Pricing
View Details
Recombinant Influenza A virus A/Victoria/2454/2019 IVR-207 (H1N1) Hemagglutinin Antigen (propiolactone inactivated)
VAC-0095 0.5 mL

Recombinant Influenza A virus A/Victoria/2454/2019 IVR-207 (H1N1) Hemagglutinin Antigen (propiolactone inactivated)

Sign In for Pricing
View Details
TH ELISA Kit (Human)
OKCD07395-96W 96 Well

TH ELISA Kit (Human)

Sign In for Pricing
View Details
α-SNAP Double Nickase Plasmid (m2)
sc-430820-NIC-2 20 µg

α-SNAP Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Recombinant Human Putative uncharacterized protein C20orf78 (C20orf78)
MBS1342342-01 0.02 mg (E-Coli)

Recombinant Human Putative uncharacterized protein C20orf78 (C20orf78)

Sign In for Pricing
View Details
Recombinant Human Putative uncharacterized protein C20orf78 (C20orf78)
MBS1342342-02 0.1 mg (E-Coli)

Recombinant Human Putative uncharacterized protein C20orf78 (C20orf78)

Sign In for Pricing
View Details