Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-4 (HV404)

This Recombinant Human Immunoglobulin heavy variable 4-4 (HV404) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-4 IGHV4-4

UniProt

A0A075B6R2

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSGTLSLTCAVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICAM2 Mouse Monoclonal Antibody [Clone ID: B-T1]
AM31349AF-N 200 µg

ICAM2 Mouse Monoclonal Antibody [Clone ID: B-T1]

Sign In for Pricing
View Details
MAFB (C-term) Rabbit Polyclonal Antibody
AP52585PU-N 400 µL

MAFB (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gephyrin (GPHN) (NM_020806) Human Over-expression Lysate
LY402806 100 µg

Gephyrin (GPHN) (NM_020806) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS500076 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Dylight 488 Conjugated Griffonia simplicifolia Lectin -GS-II-
DY488-2402-1 1 mg

Dylight 488 Conjugated Griffonia simplicifolia Lectin -GS-II-

Sign In for Pricing
View Details
Heme Microplate Assay Kit
RDSM151 100 Assays

Heme Microplate Assay Kit

Sign In for Pricing
View Details