Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-4 (HV404)

This Recombinant Human Immunoglobulin heavy variable 4-4 (HV404) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-4 IGHV4-4

UniProt

A0A075B6R2

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSGTLSLTCAVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GPR148 Antibody
NBP3-24882 100 µL

Rabbit Polyclonal GPR148 Antibody

Sign In for Pricing
View Details
Nori® Turkey Lipocalin 2 (NGAL) ELISA Kit
GR187115 96 Well

Nori® Turkey Lipocalin 2 (NGAL) ELISA Kit

Sign In for Pricing
View Details
Human Cofilin 1 Non-Muscle CLIA Kit
MBS8425230-01 1 Kit

Human Cofilin 1 Non-Muscle CLIA Kit

Sign In for Pricing
View Details
Human Cofilin 1 Non-Muscle CLIA Kit
MBS8425230-02 5x 1 Kit

Human Cofilin 1 Non-Muscle CLIA Kit

Sign In for Pricing
View Details
CTXN1 Protein Vector (Mouse) (pPM-C-HA)
PV168972 500 ng

CTXN1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Neurogranin (NRGN)
MBS2129351-01 0.1 mL

Cy3 Linked Monoclonal Antibody to Neurogranin (NRGN)

Sign In for Pricing
View Details