Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 2D-24 (KVD24)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 2D-24 (KVD24) spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 2D-24 IGKV2D-24

UniProt

A0A075B6R9

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQTPLSSPVTLGQPASISFRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCTQATQFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Hydroperoxy-1-phenylethane
TRC-H950265-500MG 500 mg

1-Hydroperoxy-1-phenylethane

Sign In for Pricing
View Details
Prostate Specific Antigen Antibody
KC-355-01 50 μL

Prostate Specific Antigen Antibody

Sign In for Pricing
View Details
Prostate Specific Antigen Antibody
KC-355-02 100 µL

Prostate Specific Antigen Antibody

Sign In for Pricing
View Details
Prostate Specific Antigen Antibody
KC-355-03 1 mL

Prostate Specific Antigen Antibody

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (CTNNB1/2098), CF594 conjugate, 0.1mg/mL
BNC942098-500 1x 500 µL

Catenin, beta (CTNNB1) (CTNNB1/2098), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STAT5B (STAT5B/2657), CF594 conjugate, 0.1mg/mL
BNC942657-100 1x 100 µL

STAT5B (STAT5B/2657), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details