Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 2D-24 (KVD24)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 2D-24 (KVD24) spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 2D-24 IGKV2D-24

UniProt

A0A075B6R9

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQTPLSSPVTLGQPASISFRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCTQATQFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nogo Receptor (RTN4R) Rabbit Monoclonal Antibody
TA423502 100 µL

Nogo Receptor (RTN4R) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ETNK2 Antibody
KC-35174-01 50 μL

ETNK2 Antibody

Sign In for Pricing
View Details
ETNK2 Antibody
KC-35174-02 100 µL

ETNK2 Antibody

Sign In for Pricing
View Details
ETNK2 Antibody
KC-35174-03 1 mL

ETNK2 Antibody

Sign In for Pricing
View Details
Rifamycin SV Sodium
TRC-R508200-1G 1 g

Rifamycin SV Sodium

Sign In for Pricing
View Details
Homovanillic Acid
TRC-H669500-50MG 50 mg

Homovanillic Acid

Sign In for Pricing
View Details