Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 2D-24 (KVD24)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 2D-24 (KVD24) spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 2D-24 IGKV2D-24

UniProt

A0A075B6R9

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQTPLSSPVTLGQPASISFRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCTQATQFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS508154 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Elk1 (Ab-383) Antibody
8B7068-AAT 50 µg

Elk1 (Ab-383) Antibody

Sign In for Pricing
View Details
4-((Propyl-d7)thio)-1,2-benzenediamine Hydrochloride
TRC-P838474-5MG 5 mg

4-((Propyl-d7)thio)-1,2-benzenediamine Hydrochloride

Sign In for Pricing
View Details
Ac-DEVD-CHO *CAS 169332-60-9*
13403-AAT 1 mg

Ac-DEVD-CHO *CAS 169332-60-9*

Sign In for Pricing
View Details
PPP2R1B Mouse Monoclonal Antibody [Clone ID: OTI8C5]
CF811459 100 µg

PPP2R1B Mouse Monoclonal Antibody [Clone ID: OTI8C5]

Sign In for Pricing
View Details
HS6ST1 Human Gene Knockout Kit (CRISPR)
KN419550 1 Kit

HS6ST1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details