Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29)

This Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-29 IGKV2D-29

UniProt

A0A075B6S2

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQPPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIQLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit
E-EL-H0145-01 24 Tests

Human PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit

Sign In for Pricing
View Details
Human PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit
E-EL-H0145-02 48 Tests

Human PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit

Sign In for Pricing
View Details
Human PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit
E-EL-H0145-03 96 Tests

Human PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit

Sign In for Pricing
View Details
FUNDC1 Rabbit Polyclonal Antibody
ER65664 100 µL

FUNDC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Annexin A13 (ANXA13) Human Gene Knockout Kit (CRISPR)
KN415571 1 Kit

Annexin A13 (ANXA13) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tex22 Mouse Gene Knockout Kit (CRISPR)
KN517438 1 Kit

Tex22 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details