Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29)

This Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-29 IGKV2D-29

UniProt

A0A075B6S2

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQPPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIQLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PASD5 (NPAS1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F3]
TA809541AM 100 µL

PASD5 (NPAS1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F3]

Sign In for Pricing
View Details
TMPRSS5 antibody
FNab08807 100 µg

TMPRSS5 antibody

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR559801 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), CF640R conjugate, 0.1mg/mL
BNC401805-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Genomic DNA, Prostate
CD564585 5 µg

Tissue Genomic DNA, Prostate

Sign In for Pricing
View Details
2-Ethyl-4-pyridinyl-boronic Acid
TRC-E925785-10MG 10 mg

2-Ethyl-4-pyridinyl-boronic Acid

Sign In for Pricing
View Details