Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29)

This Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-29 IGKV2D-29

UniProt

A0A075B6S2

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQPPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIQLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Angiotensin-Converting Enzyme 2/ACE-2 (C-6His)
AP75124-01 10 µg

Recombinant Human Angiotensin-Converting Enzyme 2/ACE-2 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Angiotensin-Converting Enzyme 2/ACE-2 (C-6His)
AP75124-02 50 µg

Recombinant Human Angiotensin-Converting Enzyme 2/ACE-2 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Angiotensin-Converting Enzyme 2/ACE-2 (C-6His)
AP75124-03 500 µg

Recombinant Human Angiotensin-Converting Enzyme 2/ACE-2 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Angiotensin-Converting Enzyme 2/ACE-2 (C-6His)
AP75124-04 1 mg

Recombinant Human Angiotensin-Converting Enzyme 2/ACE-2 (C-6His)

Sign In for Pricing
View Details
PRPSAP1 (A-9) Alexa Fluor® 790
sc-398422 AF790 200 µg/mL

PRPSAP1 (A-9) Alexa Fluor® 790

Sign In for Pricing
View Details
MFRP (Membrane Frizzled-Related Protein, Membrane-type Frizzled-related Protein, C1QTNF5, DKFZp586B0621, FLJ30570, MCOP5, MGC32938 NNO2) (AP) discontinued
129613-AP 100 µL

MFRP (Membrane Frizzled-Related Protein, Membrane-type Frizzled-related Protein, C1QTNF5, DKFZp586B0621, FLJ30570, MCOP5, MGC32938 NNO2) (AP) discontinued

Sign In for Pricing
View Details