Recombinant Human Immunoglobulin kappa variable 1-27 (KV127)
This Recombinant Human Immunoglobulin kappa variable 1-27 (KV127) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Immunoglobulin kappa variable 1-27 IGKV1-27
UniProt
A0A075B6S5
Expression Region
23-117
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYNSAP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
125479-PE 100 µL
CUGBP2 (CELF2, BRUNOL3, CUGBP2, ETR3, NAPOR, CUGBP Elav-like Family Member 2, Bruno-like Protein 3, CUG Triplet Repeat RNA-binding Protein 2, CUG-BP- and ETR-3-like Factor 2, ELAV-type RNA-binding Protein 3, Neuroblastoma Apoptosis-related RNA-binding Protein, RNA-binding Protein BRUNOL-3) (PE)
Sign In for Pricing
View Details