Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-2 (TVAL2)

This Recombinant Human T cell receptor alpha variable 12-2 (TVAL2) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-2 TRAV12-2

UniProt

A0A075B6T6

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyltransferase-Like protein 10 (METTL10) Mouse ELISA Kit
E9770 96 Tests

Methyltransferase-Like protein 10 (METTL10) Mouse ELISA Kit

Sign In for Pricing
View Details
RO4929097
2011-1 1 mg

RO4929097

Sign In for Pricing
View Details
SHARPIN sgRNA CRISPR Lentivector (Human) (Target 3)
K2142804 1.0 µg DNA

SHARPIN sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Goat anti Human IgG (H + L) (HRP)
43R-1148 1 mg

Goat anti Human IgG (H + L) (HRP)

Sign In for Pricing
View Details
WNT8b (Protein Wnt-8b, wnt8b, wnt-8b) (AP) discontinued
302844-AP 100 µL

WNT8b (Protein Wnt-8b, wnt8b, wnt-8b) (AP) discontinued

Sign In for Pricing
View Details
Anti-AHSG Antibody Picoband® (Dylight594 Conjugate)
PB9568-Dylight594 100 µg

Anti-AHSG Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details