Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-1 (TVA91)

This Recombinant Human T cell receptor alpha variable 9-1 (TVA91) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-1 TRAV9-1

UniProt

A0A075B6T8

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVVQTEGQVLPSEGDSLIVNCSYETTQYPSLFWYVQYPGEGPQLHLKAMKANDKGRNKGFEAMYRKETTSFHLEKDSVQESDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

β-arrestin1 Rabbit pAb
E45R17326N-100 100 µL

β-arrestin1 Rabbit pAb

Sign In for Pricing
View Details
Lentiviral mouse Srebf2 shRNA (UAS) - Lentiviral mouse Srebf2 shRNA (UAS, RFP) (25)
GTR15119363 1 Vial

Lentiviral mouse Srebf2 shRNA (UAS) - Lentiviral mouse Srebf2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
VNN1 Rabbit Polyclonal Antibody
orb258958 100 µg

VNN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDK3 Polyclonal Antibody
JOT-AP12905-01 20 µL

PDK3 Polyclonal Antibody

Sign In for Pricing
View Details
PDK3 Polyclonal Antibody
JOT-AP12905-02 50 μL

PDK3 Polyclonal Antibody

Sign In for Pricing
View Details
PDK3 Polyclonal Antibody
JOT-AP12905-03 100 µL

PDK3 Polyclonal Antibody

Sign In for Pricing
View Details