Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 7 (TVA7)

This Recombinant Human T cell receptor alpha variable 7 (TVA7) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 7 TRAV7

UniProt

A0A075B6U4

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENQVEHSPHFLGPQQGDVASMSCTYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDSATYFCAVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAK4-IN-5
HY-159897 1 Each

PAK4-IN-5

Sign In for Pricing
View Details
TER ATPase (Transitional Endoplasmic Reticulum ATPase, TERA, 15S Mg (2+) -ATPase p97 Subunit, Valosin-containing Protein, VCP, p97, ALS14, IBMPFD) (MaxLight 550)
135224-ML550 100 µL

TER ATPase (Transitional Endoplasmic Reticulum ATPase, TERA, 15S Mg (2+) -ATPase p97 Subunit, Valosin-containing Protein, VCP, p97, ALS14, IBMPFD) (MaxLight 550)

Sign In for Pricing
View Details
NALCN Antibody: Alkaline Phosphatase
MBS802258-01 0.1 mg

NALCN Antibody: Alkaline Phosphatase

Sign In for Pricing
View Details
NALCN Antibody: Alkaline Phosphatase
MBS802258-02 5x 0.1 mg

NALCN Antibody: Alkaline Phosphatase

Sign In for Pricing
View Details
Anti-RNA Helicase A/DHX9 Antibody Picoband®, FITC Conjugate
A02550-1-FITC 100 µg/Vial

Anti-RNA Helicase A/DHX9 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
4-Hydroxyestradiol 17-O-b-D-glucuronide
MH45077-01 1 mg

4-Hydroxyestradiol 17-O-b-D-glucuronide

Sign In for Pricing
View Details