Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 18 (TVA18)

This Recombinant Human T cell receptor alpha variable 18 (TVA18) spans the amino acid sequence from region 21-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 18 TRAV18

UniProt

A0A075B6X5

Expression Region

21-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVTQTEGPVTLPERAALTLNCTYQSSYSTFLFWYVQYLNKEPELLLKSSENQETDSRGFQASPIKSDSSFHLEKPSVQLSDSAVYYCALR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALIX Recombinant Rabbit monoclonal Antibody
HA750439 100 µL

ALIX Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human ITPRID1 activation kit by CRISPRa
GA116690 1 Kit

Human ITPRID1 activation kit by CRISPRa

Sign In for Pricing
View Details
Integrin alpha-V Antibody
KC-36478-01 50 μL

Integrin alpha-V Antibody

Sign In for Pricing
View Details
Integrin alpha-V Antibody
KC-36478-02 100 µL

Integrin alpha-V Antibody

Sign In for Pricing
View Details
Integrin alpha-V Antibody
KC-36478-03 1 mL

Integrin alpha-V Antibody

Sign In for Pricing
View Details
Galactaric Acid
TRC-G155005-50G 50 g

Galactaric Acid

Sign In for Pricing
View Details