Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-45 (LV545)

This Recombinant Human Immunoglobulin lambda variable 5-45 (LV545) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-45 IGLV5-45

UniProt

A0A087WSX0

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVLTQPSSLSASPGASASLTCTLCSGINVGTYRIYWYQQKPGSPPQYLLRYKSDSDKQQGSGVPSRFSGSKDASANAGILLISGLQSEDEADYYCMIWHSSAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reep6 3'UTR Luciferase Stable Cell Line
TU117704 1.0 mL

Reep6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
NF-kB p65 discontinued
531231-01 20 µL

NF-kB p65 discontinued

Sign In for Pricing
View Details
NF-kB p65 discontinued
531231-02 100 µL

NF-kB p65 discontinued

Sign In for Pricing
View Details
RRP15 Antibody
orb849429 2 mg

RRP15 Antibody

Sign In for Pricing
View Details
Monoclonal Antibody to Complexin 2 (CPLX2)
TRV-0059846-01 20 µL

Monoclonal Antibody to Complexin 2 (CPLX2)

Sign In for Pricing
View Details
Monoclonal Antibody to Complexin 2 (CPLX2)
TRV-0059846-02 100 µL

Monoclonal Antibody to Complexin 2 (CPLX2)

Sign In for Pricing
View Details