Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432)

This Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-2 IGHV4-30-2

UniProt

A0A087WSY4

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLQLQESGSGLVKPSQTLSLTCAVSGGSISSGGYSWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRVTISVDRSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(±)-Acetylcarnitine Chloride
TRC-A172003-10MG 10 mg

(±)-Acetylcarnitine Chloride

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3229), CF740 conjugate, 0.1mg/mL
BNC743229-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3229), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
POLR3H Mouse Monoclonal Antibody [Clone ID: OTI4D8]
CF809432 100 µg

POLR3H Mouse Monoclonal Antibody [Clone ID: OTI4D8]

Sign In for Pricing
View Details
Integrin beta 1 Recombinant Rabbit monoclonal Antibody
HA750008 100 µL

Integrin beta 1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
alpha Tubulin (TUBA4A) Goat Polyclonal Antibody
AB0046-500 1 mg

alpha Tubulin (TUBA4A) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Biotin-11-UTP, 10 mM in pH 7.5 Tris-HCl Buffer
#40033 1x 25 µL

Biotin-11-UTP, 10 mM in pH 7.5 Tris-HCl Buffer

Sign In for Pricing
View Details