Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432)

This Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-2 IGHV4-30-2

UniProt

A0A087WSY4

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLQLQESGSGLVKPSQTLSLTCAVSGGSISSGGYSWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRVTISVDRSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F(ab')2 Swine IgG (H&L) Antibody Peroxidase Conjugated
TA398258 500 µg

F(ab')2 Swine IgG (H&L) Antibody Peroxidase Conjugated

Sign In for Pricing
View Details
(3S)-3,4-Dihydroxybutanoic Acid Ethyl Ester (~90%)
TRC-D452385-50MG 50 mg

(3S)-3,4-Dihydroxybutanoic Acid Ethyl Ester (~90%)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS509663 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
KCNMA1 Rabbit Polyclonal Antibody
AP20653PU-N 100 µg

KCNMA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant CD48 Monoclonal Antibody
AN301698L-01 50 µL

Recombinant CD48 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant CD48 Monoclonal Antibody
AN301698L-02 100 µL

Recombinant CD48 Monoclonal Antibody

Sign In for Pricing
View Details