Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432)

This Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-2 IGHV4-30-2

UniProt

A0A087WSY4

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLQLQESGSGLVKPSQTLSLTCAVSGGSISSGGYSWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRVTISVDRSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMP4 Rabbit Polyclonal Antibody
JOT-AP09267-01 20 µL

DMP4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DMP4 Rabbit Polyclonal Antibody
JOT-AP09267-02 50 μL

DMP4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DMP4 Rabbit Polyclonal Antibody
JOT-AP09267-03 100 µL

DMP4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Prl3d4 AAV siRNA Pooled Vector
37687166 1.0 µg

Prl3d4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Cdk17 Knockout RAW 264.7 Polyclonal Cells
ARG12518 1 Million

Cdk17 Knockout RAW 264.7 Polyclonal Cells

Sign In for Pricing
View Details
Myosin Phosphatase Rho Interacting Protein (MPRIP) Antibody
abx326573-01 50 µg

Myosin Phosphatase Rho Interacting Protein (MPRIP) Antibody

Sign In for Pricing
View Details