Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15)

This Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-15 IGKV3D-15

UniProt

A0A087WSY6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASIRATGIPARFSGSGSGTEFTLTISILQSEDFAVYYCQQYNNWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl Cyclopropylcarboxylate-d4
TRC-E909052-25MG 25 mg

Ethyl Cyclopropylcarboxylate-d4

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS702000 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CTU2 (NM_001012759) Human Recombinant Protein
TP311052L 1 mg

CTU2 (NM_001012759) Human Recombinant Protein

Sign In for Pricing
View Details
Adora2a Mouse Gene Knockout Kit (CRISPR)
KN300919RB 1 Kit

Adora2a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ixekizumab Biosimilar - Research Grade
ICH5165-20mg 20 mg

Ixekizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
MRPL16 Antibody
8C14060-AAT 50 µg

MRPL16 Antibody

Sign In for Pricing
View Details