Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15)

This Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-15 IGKV3D-15

UniProt

A0A087WSY6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASIRATGIPARFSGSGSGTEFTLTISILQSEDFAVYYCQQYNNWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Matrin 3 (MATR3) (NM_001194956) Human Over-expression Lysate
LC434310 20 µg

Matrin 3 (MATR3) (NM_001194956) Human Over-expression Lysate

Sign In for Pricing
View Details
Thebaine
TRC-T342450-25MG 25 mg

Thebaine

Sign In for Pricing
View Details
Tsc22d3 Mouse Gene Knockout Kit (CRISPR)
KN318324LP 1 Kit

Tsc22d3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Teneligliptin Hydrobromide (2:5)
TRC-T018300-25MG 25 mg

Teneligliptin Hydrobromide (2:5)

Sign In for Pricing
View Details
Recombinant Mouse FLT-3/FLK-2 Protein (His Tag)
PKSM040347 50 µg

Recombinant Mouse FLT-3/FLK-2 Protein (His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS714366 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details