Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-8 (KVD08)

This Recombinant Human Immunoglobulin kappa variable 1D-8 (KVD08) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-8 IGKV1D-8

UniProt

A0A087WSZ0

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIWMTQSPSLLSASTGDRVTISCRMSQGISSYLAWYQQKPGKAPELLIYAASTLQSGVPSRFSGSGSGTDFTLTISCLQSEDFATYYCQQYYSFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4933413G19Rik (Tex52) (NM_027697) Mouse Tagged ORF Clone Lentiviral Particle
MR213266L3V 200 µL

4933413G19Rik (Tex52) (NM_027697) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ARHGAP10 Antibody (Center)
MBS9203762-01 0.08 mL

ARHGAP10 Antibody (Center)

Sign In for Pricing
View Details
ARHGAP10 Antibody (Center)
MBS9203762-02 0.4 mL

ARHGAP10 Antibody (Center)

Sign In for Pricing
View Details
ARHGAP10 Antibody (Center)
MBS9203762-03 5x 0.4 mL

ARHGAP10 Antibody (Center)

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) LIZ1 Polyclonal Antibody
MBS7183505 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) LIZ1 Polyclonal Antibody

Sign In for Pricing
View Details
MEIS2 Rabbit Monoclonal Antibody
E49Y8098 100 µL

MEIS2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details