Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-8 (KVD08)

This Recombinant Human Immunoglobulin kappa variable 1D-8 (KVD08) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-8 IGKV1D-8

UniProt

A0A087WSZ0

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIWMTQSPSLLSASTGDRVTISCRMSQGISSYLAWYQQKPGKAPELLIYAASTLQSGVPSRFSGSGSGTDFTLTISCLQSEDFATYYCQQYYSFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIRT6, CT (SIRT6, SIR2L6, NAD-dependent protein deacetylase sirtuin-6, Regulatory protein SIR2 homolog 6, SIR2-like protein 6) (MaxLight 650) discontinued
041763-ML650 100 µL

SIRT6, CT (SIRT6, SIR2L6, NAD-dependent protein deacetylase sirtuin-6, Regulatory protein SIR2 homolog 6, SIR2-like protein 6) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Recombinant Bovine F-box/LRR-repeat protein 4 (FBXL4) , partial
MBS1466258 Inquire

Recombinant Bovine F-box/LRR-repeat protein 4 (FBXL4) , partial

Sign In for Pricing
View Details
2-Oxa-1,4-butanediol diacetate-3,3,4,4-d4
sc-213889 5 mg

2-Oxa-1,4-butanediol diacetate-3,3,4,4-d4

Sign In for Pricing
View Details
5-Methoxy-2-phenylpyrimidin-4 (3H) -one
OR1101823-01 100 mg

5-Methoxy-2-phenylpyrimidin-4 (3H) -one

Sign In for Pricing
View Details
5-Methoxy-2-phenylpyrimidin-4 (3H) -one
OR1101823-02 250 mg

5-Methoxy-2-phenylpyrimidin-4 (3H) -one

Sign In for Pricing
View Details
5-Methoxy-2-phenylpyrimidin-4 (3H) -one
OR1101823-03 1 g

5-Methoxy-2-phenylpyrimidin-4 (3H) -one

Sign In for Pricing
View Details