Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-8 (KVD08)

This Recombinant Human Immunoglobulin kappa variable 1D-8 (KVD08) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-8 IGKV1D-8

UniProt

A0A087WSZ0

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIWMTQSPSLLSASTGDRVTISCRMSQGISSYLAWYQQKPGKAPELLIYAASTLQSGVPSRFSGSGSGTDFTLTISCLQSEDFATYYCQQYYSFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 5-cyclopropyloxazole-4-carboxylate
OR78986-01 100 mg

Ethyl 5-cyclopropyloxazole-4-carboxylate

Sign In for Pricing
View Details
Ethyl 5-cyclopropyloxazole-4-carboxylate
OR78986-02 250 mg

Ethyl 5-cyclopropyloxazole-4-carboxylate

Sign In for Pricing
View Details
Ethyl 5-cyclopropyloxazole-4-carboxylate
OR78986-03 1 g

Ethyl 5-cyclopropyloxazole-4-carboxylate

Sign In for Pricing
View Details
Ethyl 5-cyclopropyloxazole-4-carboxylate
OR78986-04 5 g

Ethyl 5-cyclopropyloxazole-4-carboxylate

Sign In for Pricing
View Details
Ethyl 5-cyclopropyloxazole-4-carboxylate
OR78986-05 10 g

Ethyl 5-cyclopropyloxazole-4-carboxylate

Sign In for Pricing
View Details
TCTE3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2352505 3x 1.0 µg

TCTE3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details